SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256395002|ref|YP_003116566.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|256395002|ref|YP_003116566.1|
Domain Number - Region: 147-213
Classification Level Classification E-value
Superfamily Prim-pol domain 0.000168
Family PriA-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256395002|ref|YP_003116566.1|
Sequence length 357
Comment DNA polymerase LigD, polymerase domain-containing protein [Catenulispora acidiphila DSM 44928]
Sequence
MCPGVRMSVAGRSLPTMGSAEAHVEAGGRSVRISSPDKLLFPDADVTKLGLATYYAAVAD
GLFRGLANRPVALNRFPDGLGGKSFFTKSAPKGLPDWASTAHVTFPSGRTGDEVCVTEPA
TVLWTVQMGTLELHAWPVREADTDHPDELRIDLDPQPGTGFAEAVEVAREALALFEELGI
RPFVKTSGGRGLHLLVRIEPRWTFVEARRAVIALARELERRRPEMVTTSWWKEERGERIF
IDFNQMARDRMTVAPYSTRARPDAPVSMPVRWADLADVAPGDFTVKTVPDLFAKNGDANA
EIDDTAHSLDALLEMAERDEKDHGLGDMPYPPDFPKMPGEPKRVQPSKARHDQEGGS
Download sequence
Identical sequences C7QDV1
gi|256395002|ref|YP_003116566.1| WP_015794454.1.73754 479433.Caci_5867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]