SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|451822151|ref|YP_007458352.1| from Clostridium saccharoperbutylacetonicum N1-4(HMT)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|451822151|ref|YP_007458352.1|
Domain Number 1 Region: 10-205
Classification Level Classification E-value
Superfamily CAC2185-like 3.14e-82
Family CAC2185-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|451822151|ref|YP_007458352.1|
Sequence length 208
Comment exopolysaccharide biosynthesis protein [Clostridium saccharoperbutylacetonicum N1-4(HMT)]
Sequence
MLFYSEIINILRKRINMKNSKRLKNKDFSLLASNCNGAFILHDLNLKFNSPTVNLFMYPS
DFVKYIKNLEYYSKCDLKFIKKEDTAYPVGKLDDIEIHFMHYKDENEAERKWKERTDRID
FDNMFVMMTDRDGCSLEDLKEFDKLPYKNKVVFTHKEYSEIKSSVYIKGFENEKNVGNLY
SYKNRFTGYKYYDDFDYVEWFNSRTAEK
Download sequence
Identical sequences M1MSH6
WP_015395405.1.28153 WP_015395405.1.48829 gi|451822151|ref|YP_007458352.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]