SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|451818681|ref|YP_007454882.1| from Clostridium saccharoperbutylacetonicum N1-4(HMT)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|451818681|ref|YP_007454882.1|
Domain Number 1 Region: 35-675
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.63e-292
Family Cellulases catalytic domain 0.000000000000251
Further Details:      
 
Domain Number 2 Region: 682-739
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000589
Family Type I dockerin domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|451818681|ref|YP_007454882.1|
Sequence length 741
Comment endoglucanase A [Clostridium saccharoperbutylacetonicum N1-4(HMT)]
Sequence
MIKAKLKILVASVMCSAICLTPLFNTAAMAATTAQNASTTQTDEYQQRFMTMWGKIHDSK
NGYFKNFTDGGTTLKVPYHSVETFMCEAPDYGHETTSEAYSYYMWLEAMYGKFTGNWNEF
KNAWDSADKYIIPHGQDQAGMNAYNPNSPATLANEYPTINKYPSKLLFGTPVGKDPINNE
LKNAYGSGEMYGMHWLLDVDNWYGYGNRGDANSNAPAYINTFQRGSEESVWKTVPQPSYE
TFKWGGKNGYLDLFTGDNNYSKQWRYTDAPDADARAIQATYWADEWAKTQGKDVSQYVSK
ASKMGDYLRYSMFDKYFKPIGVGADQQTEASGQHYLLSWYYAWGGGAGGDWSWKIGCSHN
HFGYQNPMTAWVMSKDADFKPKSSGGASDWNKSLDRQLELYQWLQSSEGGIAGGATNSLT
TDAGSYQKYPEGTPTFYGMAYDWQPVYHDPPSNNWFGMQTWSMQRVAELYYKTGDKRAQA
VLDKWTKWVKSVVKLNDDGTYAIPNNLTWSGQPDTWNGTYTGNPGLHVDVKDYSQDVGVT
SSLANTLTYYAAASNKYSTFDKDSAKLAKELLDRMWKLDQDSKGLSVEEERADYSKIFDT
KVYIPDGWSGKMPNGDVIKPGVSFLDIRSKYKQDPDFAKVEEAYKEGKAPVFKYHRFWAQ
SEAAIANGAYSILSKEFPADSILKGDVTGDGTVDIQDYIALQKYILDPATQINAANADVN
GDGRVNTADLFALRKMVLDNQ
Download sequence
Identical sequences M1MH14
WP_015391949.1.28153 WP_015391949.1.48829 gi|451818681|ref|YP_007454882.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]