SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|451818682|ref|YP_007454883.1| from Clostridium saccharoperbutylacetonicum N1-4(HMT)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|451818682|ref|YP_007454883.1|
Domain Number 1 Region: 304-803
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 8.08e-137
Family Cellulases catalytic domain 0.000000000103
Further Details:      
 
Domain Number 2 Region: 32-196
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.42e-31
Family CBM4/9 0.0026
Further Details:      
 
Domain Number 3 Region: 208-302
Classification Level Classification E-value
Superfamily E set domains 2.73e-25
Family E-set domains of sugar-utilizing enzymes 0.00047
Further Details:      
 
Domain Number 4 Region: 813-870
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000034
Family Type I dockerin domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|451818682|ref|YP_007454883.1|
Sequence length 871
Comment cellulose 1,4-beta-cellobiosidase CelK [Clostridium saccharoperbutylacetonicum N1-4(HMT)]
Sequence
MIRKKIACLMLAGSLFMSFVPTTFANAADKVSVGNLIKNNTFDNGVGLPWNQVETYPADA
DFDIDNGTYNVTIKTPDETKSKDTRWGVQFRHRGLTLEQGHTYEVSFTVKATADCKVYPK
IGQQGKEYKEYWNYNHKGWEPLSLKANQPVTVKETFTMTDPTENACEFAFHLAGDCLAAN
LPYTVSFDNINLKDPQFPGYDKEPEEPTNAVRVNQVGYFTDLEKKATVVSSSTTPIAWRL
LDSSNNVVKSGQTTVFGKDHASGDNVHTIDFSDFKTEGKGYKLAVDSADVSPKESMKFDI
GNSIYSKMKSDAIKYFYNNRSGIEIKGNYAGRADLARPAGHPNDVLGNAPNTWYKANYTL
DVTGGWYDAGDHGKYVVNGGISTWTMMNQYERALYNKVDLKRAPFGDGTMNIPESGNGIP
DILDESRWNLQTLLKMQVPDGNELAGMVHHKAHDERWTALGIRPDQDPQKRYLQPPSTAA
TLNLAAIAAQGSRLWKSYDSAFASKCLASAEKAWDAAVAHPDKLAPLTGAIGGGAYGDNK
VDDEFYWAACELYATTGESKYLDYIKSSKYYLQMPTSLTGGEDNGITGPFDWGNVQGLGT
ITLALVPNGLPKEDVDTAKKNIKAAADAFITNENKEGYGTPMTEGPYGSPLNDGSAPSGK
GYPWGSNSLVVNEGIVMAYANDFSDKTDNKYINGAERSMDYILGCNPNVQSYITGYGSNP
LENPHHRFWAYQTDNTFPKAPAGAMAGGPNSGLEDPWVKGSGWKPGSRPAAKCFMDNIES
WSTNEVTINWNAPFAWMSSYMDDNGGQKGGNAVKGDVNNDGEVDSMDYIALQKYIMDPSN
SNINTANADLNGDGKINTADLFALRKTIINS
Download sequence
Identical sequences M1MCJ0
gi|451818682|ref|YP_007454883.1| WP_015391950.1.28153 WP_015391950.1.48829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]