SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383753542|ref|YP_005432445.1| from Selenomonas ruminantium subsp. lactilytica TAM6421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383753542|ref|YP_005432445.1|
Domain Number 1 Region: 50-171
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 2.62e-43
Family Insert subdomain of RNA polymerase alpha subunit 0.0000243
Further Details:      
 
Domain Number 2 Region: 3-50,172-224
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 8.83e-31
Family RNA polymerase alpha subunit dimerisation domain 0.00083
Further Details:      
 
Domain Number 3 Region: 251-317
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 6.67e-25
Family C-terminal domain of RNA polymerase alpha subunit 0.0000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383753542|ref|YP_005432445.1|
Sequence length 319
Comment putative DNA-directed RNA polymerase subunit alpha [Selenomonas ruminantium subsp. lactilytica TAM6421]
Sequence
MIDIEKPKIEIVEISEDNRYGKFVCEPLERGYGTTFGNSLRRMLLSSLEGSAITSIRIDG
VLHEFSTIPGVRDDVTNIVLNLKQLCLKMAGSEPKVIRIDVEGEKEVTAADIICDADIEI
LNPDLHIATVDATGKLKIEMTVARGRGYIPAERNKKPDDTIGVIPIDSIFSPVQRVNYTV
QDTRVGNETDYDKLILEVWTDGSLRPEEAVSKAAGILVMHLKLFQSMDGLPEEIEEEEAT
FPEEVEDDTSKVLEMTIEDLDLSVRSFNCLKRANINTVADLAEKTEDDMMKVRNLGRKSL
EEVKKKLEELGLALRVNND
Download sequence
Identical sequences A0A1H0TAU7 I0GNT5
WP_014423861.1.93961 WP_014423861.1.94138 gi|383753542|ref|YP_005432445.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]