SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383754232|ref|YP_005433135.1| from Selenomonas ruminantium subsp. lactilytica TAM6421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383754232|ref|YP_005433135.1|
Domain Number 1 Region: 5-115
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000000942
Family HD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383754232|ref|YP_005433135.1|
Sequence length 186
Comment hypothetical protein SELR_14040 [Selenomonas ruminantium subsp. lactilytica TAM6421]
Sequence
MSKLTLDRAKEILAKHTTEEHLFHHAAAVSAAMGAMAEAYGEDKDYWAAIGWLHDVDYEK
FPDEHCHHVRELLAPEGVDEEDIKAIITHGYEITTDEAEPVNNLEKSLFAVDELTGIIQA
YALMRPEKMEGMAVKSLKKKYKDKRFAAKCNREIIDKGVEKLGMELSEVMSHCIKGMTEH
SDEIGL
Download sequence
Identical sequences I0GQS5
WP_014424549.1.93961 gi|383754232|ref|YP_005433135.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]