SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383754420|ref|YP_005433323.1| from Selenomonas ruminantium subsp. lactilytica TAM6421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383754420|ref|YP_005433323.1|
Domain Number 1 Region: 7-250
Classification Level Classification E-value
Superfamily SIS domain 1.22e-69
Family mono-SIS domain 0.000000318
Further Details:      
 
Weak hits

Sequence:  gi|383754420|ref|YP_005433323.1|
Domain Number - Region: 241-277
Classification Level Classification E-value
Superfamily UBA-like 0.0138
Family UBA domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383754420|ref|YP_005433323.1|
Sequence length 302
Comment putative N-acetylmuramic acid 6-phosphate etherase [Selenomonas ruminantium subsp. lactilytica TAM6421]
Sequence
MIDLQKLSTERRNPATAHIDELSTLSMLQVINEEDKKVALAVEKILPEVAKAVDVITDRL
SKGGRLFYMGAGTSGRLGILDASECPPTYGVEPELVQGLIAGGIPAIFKAQEGAEDSPEL
GQKDLREKDFSAKDVLVGIAASGRTPYVIGGLQYAKDVGAATIALACSPEPAIGDFADIV
LVPVTGAEVVTGSTRMKAGTAQKLVLNMLSTGTMIKLGKVYGNLMVDVKTSNKKLEERAR
RIVMEATGCSREESIAALMEAQGNAKLAIFIHLTGTDFATGQEYLGKAHGHLGAALQQRG
VG
Download sequence
Identical sequences I0GRB3
gi|383754420|ref|YP_005433323.1| WP_014424735.1.93961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]