SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|241191185|ref|YP_002968579.1| from Bifidobacterium animalis subsp. lactis Bl-04

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|241191185|ref|YP_002968579.1|
Domain Number 1 Region: 22-146
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 2.75e-23
Family Thiamin pyrophosphokinase, catalytic domain 0.0039
Further Details:      
 
Domain Number 2 Region: 178-234
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.00000628
Family Thiamin pyrophosphokinase, substrate-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|241191185|ref|YP_002968579.1|
Sequence length 268
Comment hypothetical protein Balac_1161 [Bifidobacterium animalis subsp. lactis Bl-04]
Sequence
MGAGIICVARQRKSPASQAEGVTTNTASRICVVFGAGEYYTRPYSLPEHAFVVAADGGYA
HARELGVHVDVVVGDFDSTEDLATESTSDPGMRTLRLPPEKDDPDMLSALKVGWRHGSRE
FHIYGGLGGRVDHTISDIQQTAIVASHGGIAYLHGDGRIVTAISDAALHFAAHEVADTQY
VSVFAHSDSVRDVTERGLKYRLDHATLSNLQVNGLSNEFIDGDAAQIAVGGGIAIIVFDD
RAPLPELVGATPHGTLGEPSTHVTDALA
Download sequence
Identical sequences A0A2G9IQ14 B8DSQ3
gi|384195747|ref|YP_005581492.1| gi|387821051|ref|YP_006301094.1| gi|549472639|ref|YP_008606346.1| gi|219683225|ref|YP_002469608.1| gi|241191185|ref|YP_002968579.1| gi|387822730|ref|YP_006302679.1| 442563.BLA_0739 555970.Balat_1161 580050.Balac_1161 gi|384194182|ref|YP_005579928.1| gi|518657553|ref|YP_008143915.1| gi|241196591|ref|YP_002970146.1| WP_004218696.1.14456 WP_004218696.1.16162 WP_004218696.1.20477 WP_004218696.1.21588 WP_004218696.1.22654 WP_004218696.1.23267 WP_004218696.1.23846 WP_004218696.1.23969 WP_004218696.1.26294 WP_004218696.1.34099 WP_004218696.1.38287 WP_004218696.1.38998 WP_004218696.1.45260 WP_004218696.1.45775 WP_004218696.1.47471 WP_004218696.1.47549 WP_004218696.1.50484 WP_004218696.1.53490 WP_004218696.1.62237 WP_004218696.1.66072 WP_004218696.1.75174 WP_004218696.1.78909 WP_004218696.1.86686 WP_004218696.1.86797 WP_004218696.1.94304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]