SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocca1|103091|e_gw1.152.40.1 from Cochliobolus carbonum 26-R-13 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocca1|103091|e_gw1.152.40.1
Domain Number 1 Region: 203-355
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000137
Family UBX domain 0.051
Further Details:      
 
Domain Number 2 Region: 2-113
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000138
Family Thioltransferase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocca1|103091|e_gw1.152.40.1
Sequence length 477
Sequence
MFHEGTLQSGIALAIKEQKLVACFVRDDGATSKEWEEEWLTSGWLSSLLAQKAVLLRLEA
GSTEAGFLAAFSDLSEIPTFVVIHNGQLQIQLKSHVTKDEFINSIRRVLRANPIPGSNTA
PTSPPQAGTLDSSSSYNTAAAEDDLYGPEEPYTPTQAEPAAAPPPSANAKGKQRMASAST
SKSTSSASTNKAQQEARDALRKKKKEEAEELARVKARIEADKAARRAEAEARKAEREKER
NKEAQTSPPPHTTTSSSRGSRAKHVNLNVRLFDGRTIRSTFPREATLQEEVRKWVDLEFS
KLSQDDANINHKQLPPYYFRHILAPQPSRELSAGDESQSLGDIDLAPSATLVLVPVKGYT
EAYSGAEGGVVGAATGLVGGAFGLLASTVGFVSNTIGSAIGYGSQGASSSSSQQQHRPGG
GHTVGSRTSQEPQHDTPNNPGFRVRTLADQRGREPQQFYNGNQLSTEHRPEDNDKRD
Download sequence
Identical sequences W6XZM2
XP_007714967.1.9443 jgi|Cocca1|103091|e_gw1.152.40.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]