SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocca1|105661|e_gw1.193.36.1 from Cochliobolus carbonum 26-R-13 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocca1|105661|e_gw1.193.36.1
Domain Number 1 Region: 9-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.45e-23
Family Ubiquitin-related 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocca1|105661|e_gw1.193.36.1
Sequence length 98
Sequence
MSENGSPNNVQQKPEDGGQSEHLNIKVTDNNNEVFFKIKRTTALGKLMNAFCDRQGKNIS
SVRFLFDGQRVTAQDNPDTLDMQDGDTLEVHQEQIGGC
Download sequence
Identical sequences M2TE99 N4XG00 W6YEX0 W6ZFE1 W7F1Q8
jgi|Cocvi1|21573|gm1.177_g jgi|CocheC5_1|9021|fgenesh1_kg.C_scaffold_2000104 jgi|Cocca1|105661|e_gw1.193.36.1 jgi|Cocmi1|81386|e_gw1.4.236.1 XP_007682890.1.18027 XP_007715930.1.9443 XP_014084569.1.79200 XP_014562552.1.39273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]