SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocca1|1229|gm1.1229_g from Cochliobolus carbonum 26-R-13 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocca1|1229|gm1.1229_g
Domain Number 1 Region: 415-576
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.21e-23
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 305-401
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000255
Family Rhamnogalacturonase B, RhgB, middle domain 0.029
Further Details:      
 
Domain Number 3 Region: 114-301
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000267
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocca1|1229|gm1.1229_g
Sequence length 578
Sequence
MKALLPLLCGGAGIVASASAYSQHPSAPEQPKSFFRQIGNSTWILGNELWNVTQNAQYAT
KLMYRGKDRVGEAVGHYVSYNGAASDLRWTTASIAASGSNWLDIRFSAAEGDFHWVLHDH
LAGAYQYFINRGLPTLGEFRSLWRLSNTSFPHASTNTKTGLLPPLSLYQNATNVQDETWQ
QSDGTFLTKYDWAAFLREQTAYGVWGDEVGSWYLHAGKEYLNGDHLKQELMVHRESKTGD
TVQLNMLHGTHYQASSRDSFAAGNDEARIWGPWLWYLNDGSRQDAVERWEREEKEWPYAW
FENAAYQSRGAVQGKLVLSDGRPAAGAAVFLGDNRNETVSTLDQGQNYYYTAYADDAGEF
RIRDVRSGTYALYAWGNGRSIADVITNFTHNDVEIVKRKTTSLPLLTWSVTDKTKRIFQI
GDFDRKTDGFYLADPAIPVQHARIDKCPANLTYTVGTSTPPKDWCFGQSKVGTWSVSFPA
SLDNSTAAKLVVSLAGFSQGSSADILLNEAKIGNITSASLANSQDTYRGATRAGEWRRLE
FGVPRGLLKEGQNRLDVRVTKSTQWRGWLWDSLVLEAV
Download sequence
Identical sequences W6YRF4
jgi|Cocca1|1229|gm1.1229_g XP_007707683.1.9443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]