SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocca1|32383|fgenesh1_pm.5_#_16 from Cochliobolus carbonum 26-R-13 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocca1|32383|fgenesh1_pm.5_#_16
Domain Number 1 Region: 97-231
Classification Level Classification E-value
Superfamily Cap-Gly domain 2.09e-36
Family Cap-Gly domain 0.00015
Further Details:      
 
Domain Number 2 Region: 8-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.51e-17
Family Ubiquitin-related 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocca1|32383|fgenesh1_pm.5_#_16
Sequence length 245
Sequence
MSLQSAADVPLLISSPNSSSERRISPSWTIAHLKTRLEPITGIPAGCQQLSLRVASQDPV
ALVAADEEHTQLVAFPLQPYAEIAVVDTRPPAARTDFNDLSAVEKYEMPVAEYEHRTDSV
LAWKKAQKLGRFDPNAPSIEQQKIRASEREVEERGLSVSSRVRLLPESDARRGTVSYIGL
IPEIPGIGVWVGVTLDEPTGKNDGSVKGKRYFECGPNYGVFVRPERCEAGDFPPLDMGDE
DLEEM
Download sequence
Identical sequences W6YLQ2 W7EPJ8
jgi|Cocca1|32383|fgenesh1_pm.5_#_16 jgi|Cocvi1|85219|e_gw1.3.173.1 XP_007707176.1.9443 XP_014561939.1.39273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]