SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocca1|35178|fgenesh1_pm.40_#_39 from Cochliobolus carbonum 26-R-13 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocca1|35178|fgenesh1_pm.40_#_39
Domain Number 1 Region: 15-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.87e-17
Family Ubiquitin-related 0.0017
Further Details:      
 
Domain Number 2 Region: 95-163
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 3.92e-17
Family AN1-like Zinc finger 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocca1|35178|fgenesh1_pm.40_#_39
Sequence length 171
Sequence
MARSSSISSMSSSSSDAEETMQIFVKTVSGNNTIPLTIPSNTSIRTLRSLLALRTNLHSP
SDLRIVHAGKHLSSPETTLSDYAIGPNSTLHLALPLRGGMPPKKIRCSFKDCKDRAQPIV
GDCGFCTGHHCSKHRMLEDHKCEGLEDCKKESHSRNADKLNSERTVAIKGV
Download sequence
Identical sequences M2RQP2 M2VCP5 N4WLV8 W6YCH9 W7E3Z8
jgi|Cocca1|35178|fgenesh1_pm.40_#_39 jgi|Cocvi1|110208|e_gw1.108.4.1 XP_007695621.1.66866 XP_007710379.1.9443 XP_014075268.1.79200 XP_014552500.1.39273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]