SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocca1|3903|gm1.3903_g from Cochliobolus carbonum 26-R-13 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocca1|3903|gm1.3903_g
Domain Number 1 Region: 20-332
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.51e-61
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.019
Further Details:      
 
Domain Number 2 Region: 439-656
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.89e-19
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.078
Further Details:      
 
Domain Number 3 Region: 338-435
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000235
Family Rhamnogalacturonase B, RhgB, middle domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocca1|3903|gm1.3903_g
Sequence length 658
Sequence
MRAITVTATLLFCTNTWAFLKASQNNQSLTIANNRLVASVSKSKGYINVLTLDGQNLLGT
ESGNTGVGPYLDCYCTPSGFWTPGRGKDVQYQLFNGTDSTGTPYGGISMGETYAPTGQRL
EQYWFLREGETGLHTFSRIVYYNETTPFLRNLQEFRTLFRPNHDPPLFTHFITNDKFSAP
RPDQNGQVVVQDATWQLVNKDDPYVKGVGDYFTKYTFQDSWRNHLAHGMYADGRTTNGTT
YGAWLVHNTVETYFGGPTHSDLVVDGIVYNYMVSNHHGAQTPNITNGFDRTFGPQYFHFN
TGGTLSELRKDAEQYGQRPDWNAPFYDSIAAHVPNLITSSARGTFSANIALPTGAQNPIA
ILTTTGHNYQDNAANSTAYQYWTPIPSTGTISIPRVKPGSYRLTLSASSIFGDYTHDSLL
ISASQTTSLNITWTPESAGKELFRIGTPDKSSGEFLHGTAPSPTHPLLTEEYRLYWAAYD
FIRDFPTGIHFRVGKDDPAQALNYVHWAVFGGKANSLRPVPVPDHVYDWSIRFDVEEGDV
KESGKATFTVQLAGAKTAAGNTDLDTGERWANLPLRVMVNGEGLEDWVIPYYQSSSCAVR
SAVSCYHLAHKFVFSGDLLKEGENEIVLALPYNATGNESAVLPEAVYVQYDALRLEVE
Download sequence
Identical sequences W6YTI0
XP_007710877.1.9443 jgi|Cocca1|3903|gm1.3903_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]