SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocca1|6194|gm1.6194_g from Cochliobolus carbonum 26-R-13 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocca1|6194|gm1.6194_g
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.2e-27
Family Ubiquitin-related 0.0000839
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocca1|6194|gm1.6194_g
Sequence length 77
Sequence
MQIKVRTLTGKEIELDIEADYKVSRIKERVEEKEGIPPAQQRLIYGGKQMSDDKTAADYQ
LEGGATLHLVLALRGGY
Download sequence
Identical sequences A0A0L1HPH3 M2T454 M2UH38 N4XHM7 W6XX23 W7EA24
jgi|Cocvi1|30209|gm1.8813_g XP_007700451.1.66866 XP_007713667.1.9443 XP_014078526.1.79200 XP_014552397.1.39273 jgi|CocheC5_1|96916|estExt_Genewise1Plus.C_10177 jgi|Cocca1|6194|gm1.6194_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]