SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocca1|6622|gm1.6622_g from Cochliobolus carbonum 26-R-13 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocca1|6622|gm1.6622_g
Domain Number 1 Region: 178-312
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.78e-19
Family UBX domain 0.0046
Further Details:      
 
Domain Number 2 Region: 5-41
Classification Level Classification E-value
Superfamily UBA-like 0.0000000334
Family UBA domain 0.0062
Further Details:      
 
Weak hits

Sequence:  jgi|Cocca1|6622|gm1.6622_g
Domain Number - Region: 70-104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00392
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocca1|6622|gm1.6622_g
Sequence length 313
Sequence
MASSDLDTLVDMGFDRERAELAVKVSGGLQSAIDWLETNQDKSIDEIKQAQASSAAGASD
EPPALQPGEEAKSLVCDECGKKFRSVNQAQFHGEKTGHEQFSESTEEIAPLTEEEKKQRL
QELREKLAAKRAKMSEQDKEDQKRNEQIRMKATKESQDIREELQKKERLKEAAAKRAEKK
ADEEARKRVLAKLEADKQERKRKAEEEKAKRAGQAPPAPAAQAPLATSSGPSTSKPASAY
TEARLALQTPSGRVMKTFPVETTLFEVAHALEQDGLSVNTFTTNFPKKTYDKTDFGMTLK
EAGMIPSAALIVG
Download sequence
Identical sequences W6YJJ8
jgi|Cocca1|6622|gm1.6622_g XP_007714205.1.9443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]