SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocca1|87478|e_gw1.21.109.1 from Cochliobolus carbonum 26-R-13 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocca1|87478|e_gw1.21.109.1
Domain Number 1 Region: 48-134
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.4e-24
Family APG12-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocca1|87478|e_gw1.21.109.1
Sequence length 135
Sequence
MSESPKEKIPEEDDTTEAPLSMAASVVLSSLPKDASKALETAGNLNVQKVTIRLQPIGSA
PHLTQRIFKLSTNQNFATIVRFLRKRLGVKEHESVFCYVGNVFSPGLDEGVGNLWSCFKQ
GEELVVGYALSPAFG
Download sequence
Identical sequences W6YMN4 W7EKS6
jgi|Cocvi1|37301|fgenesh1_pm.37_#_39 jgi|Cocca1|87478|e_gw1.21.109.1 XP_007708964.1.9443 XP_014557184.1.39273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]