SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocca1|9371|gm1.9371_g from Cochliobolus carbonum 26-R-13 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocca1|9371|gm1.9371_g
Domain Number 1 Region: 45-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000632
Family Ubiquitin-related 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocca1|9371|gm1.9371_g
Sequence length 241
Sequence
MSEFAFCKSFLSALDARPVKLSSDHIADARQYPAQGAYTLPRLPHPPHPQRPNPKSTDSA
DASTSASTITVTLKPMKPSTPTIPLSAIDPSKTSVYDLKQQYATQASLSAAKIKILYKKK
PVTDSKTLKEVIGTDAGTEVEFGVMVMAGAAAASGSPAAGGTPVTSPPAVAPPTESEKGL
ASAGESSAGASVAAGAVSGKDIVATDEFWGDLKTFILQRTKDAEEGERLVGVFKAAWEQN
K
Download sequence
Identical sequences W6XRI5
XP_007717481.1.9443 jgi|Cocca1|9371|gm1.9371_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]