SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Cocca1|89375|e_gw1.30.30.1 from Cochliobolus carbonum 26-R-13 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocca1|89375|e_gw1.30.30.1
Domain Number 1 Region: 687-785,812-924
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.92e-46
Family Extended AAA-ATPase domain 0.000000115
Further Details:      
 
Domain Number 2 Region: 994-1064
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 0.000000000000145
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.002
Further Details:      
 
Domain Number 3 Region: 1-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000176
Family Ubiquitin-related 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocca1|89375|e_gw1.30.30.1
Sequence length 1070
Sequence
MILRFVSKEGQFRLTVQPEDTFPDILPQIAEKLPKNVDLESLSVSNRPQGGDARKFVDLK
GVSFKQVNLSNGAQLFLAFEEQSTPSNGHAAIASGGARLNGKPVQPSETASVPLDGPTQI
IKKPWEVVRQSPLDDRLDRQDGKIPRKRDARMCTHGPKGMCDYCMPLEPYSPEYLAEKKI
KHLSFHSYLRKVNSAKNRPELGSSYIPPLTEPYYRVRPDCPSGHKPFPEGICTKCMPSAI
SLKPQEYRMVDHVEFASIQVVDDLINFWRQTGCQRLGFLYGRYEEYTEVPLGTKAVVETI
YEPPQINEVDGISLGDWDNEQVIDDIAAQCGLQRVGVIFTDLLDADKGDGSVICKRHIDS
YYLSSLEVCFSARYQAKYPRPSKWSDTGRHGSNFVTCVISGDDQGQIGISSYQVSNDAVE
MVRADIIEPSAEPKVMLVQSEEDNEALNRTRYIPEVFYRKINEHGANVQEIAKPDFPVEY
LLLTLTHGFPTQPNPLFTGGKFPIENREAMGEMPEITHLSKALNAKANGLALNTASGLKA
ISNFHMLCFIHNLGILSKDEESLLFKVASTHDTSEGSALQHTPGWATLLTILKESGERPP
KRSYQSPSPSQPARRGAAAPLPLEHQRTMRQPSYGSDSDSVQLAKRVKGPPQVTMADFFN
IKARQQAAAQASSSKAPTTKQEPNRLQPWVEKYRPKTLSEVTAQDNTIQVLSRTMQSSNL
PHMLFYGPPGTGKTSTILALAKELYGPELMKSRVLELNASDERGISIVRQKVKDFARQQL
SVAPTYNVMVEDKSGTGEGGMVRYRDKYPCPPFKIIVLDEADSMTQDAQSALRRTMETYS
RMTRFCLVCNYVTRIIDPLASRCSKFRFKSLDQGNAVKRVSDIAALESVRLDDGVAEELV
RVADGDLRKAITFLQSAARLVGAIQSQGGGSKKGKKRTAVPEDDEMDIDSGSTATPSVSL
PTIAEIAGVLPPETLSTFTSALFPKSSAQKTIRYNEIAKVVENMVAEGWSAAQTVGQLYE
QIMFDERVEDVKKVRLAVVFSETDKRLVDGSDEHLAVLDLGVRVAGVLCL
Download sequence
Identical sequences W6YED2
XP_007709742.1.9443 jgi|Cocca1|89375|e_gw1.30.30.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]