SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221633838|ref|YP_002523064.1| from Thermomicrobium roseum DSM 5159

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221633838|ref|YP_002523064.1|
Domain Number 1 Region: 218-391
Classification Level Classification E-value
Superfamily SIS domain 1.5e-33
Family mono-SIS domain 0.00023
Further Details:      
 
Domain Number 2 Region: 26-168
Classification Level Classification E-value
Superfamily SIS domain 8.4e-16
Family mono-SIS domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221633838|ref|YP_002523064.1|
Sequence length 395
Comment phosphoheptose isomerase [Thermomicrobium roseum DSM 5159]
Sequence
MGQPLSRFVHDRLLERNTLSRAFFPCEAERLAAICREMAERFLAGGRLLAFGRGPYATDA
QHVSVEFIHPVIVGKRALPALDLSLSFAEWSTAILQPQDIVMGFGSPEGDPLVQRILAVL
RSRGALTLALPGKGESADYAVETPTADPFIHQELLEVLYHTLWETVHVFFEHRQLAGYEV
GELAAFYPFLGGTPVDLRAVEPEVAGSIIAKAEEVERLRAELAREQAGVIADTAVAIAQR
LERGGKLICLGNGGSATDANDLAVDCVMPPAGYHSLPAISLALEPANLTAIANDVGQEVM
FLRQLIPHAQAHDVVIGFSTSGGSTNVIMALEEARKRGLLTVGLLGYDGGEILRRQLVDH
AIVVHCDYIPRIQEAQASAYHVLREALEVTLYGTA
Download sequence
Identical sequences B9L1W5
gi|221633838|ref|YP_002523064.1| 309801.trd_1865 WP_015922807.1.69661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]