SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229587275|ref|YP_002860313.1| from Clostridium botulinum Ba4 str. 657

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229587275|ref|YP_002860313.1|
Domain Number 1 Region: 2-546
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.83e-181
Family Clostridium neurotoxins, catalytic domain 0.000000000000009
Further Details:      
 
Domain Number 2 Region: 549-875
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 1.7e-114
Family Clostridium neurotoxins, "coiled-coil" domain 0.0000000000607
Further Details:      
 
Domain Number 3 Region: 1080-1295
Classification Level Classification E-value
Superfamily STI-like 5.89e-81
Family Clostridium neurotoxins, C-terminal domain 0.00000000175
Further Details:      
 
Domain Number 4 Region: 875-1079
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-48
Family Clostridium neurotoxins, the second last domain 0.0000000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229587275|ref|YP_002860313.1|
Sequence length 1296
Comment botulinum neurotoxin type BvA4, BoNT/BvA4 [Clostridium botulinum Ba4 str. 657]
Sequence
MPFVNKQFNYNDPENGVDIAYIKIPNAGKMQPVKAFKIHNKVWVIPERDIFTNPEEVDLN
PPPEAKQVPISYYDSAYLSTDNEKDNYLKGVIKLFERIYSTDLGRMLLISIVRGIPFWGG
GKIDTELKVIDTNCINIIQLDDSYRSEELNLAIIGPSANIIESQCSSFRDDVLNLTRNGY
GSTQYIRFSPDFTVGFEESLEVDTNPLLGAGKFAQDPAVALAHELIHAEHRLYGIAINTN
RVFKVNTNAYYEMAGLEVSLEELITFGGNDAKFIDSLQKKEFSLYYYNKFKDIASTLNKA
KSIVGTTASLQYMKNVFKEKYLLSEDATGKFLVDRLKFDELYKLLTEIYTEDNFVKFFKV
LNRKTYLNFDKAVFKINIVPDVNYTIHDGFNLRNTNLAANFNGQNIEINNKNFDKLKNFT
GLFEFYKLLCVRGIITSKTKSLDEGYNKALNELCIKVNNWDLFFSPSEDNFTNDLDKVEE
ITSDTNIEAAEENISLDLIQQYYLNFNFDNEPENTSIENLSSDIIGQLEPMPNIERFPNG
KKYELNKYTMFHYLRAQEFKHSNSRIILTNSAKEALLKPNIVYTFFSSKYIKAINKAVEA
VTFVNWIENLVYDFTDETNEVSTMDKIADITIVIPYIGPALNIGNMIYKGEFVEAIIFSG
AVILLEIVPEIALPVLGTFALVSYVSNKVLTVQTIDNALSKRNEKWDEVYKYIVTNWLAI
VNTQINLIREKMKKALENQAEATKAIINYQYNQYTEEEKNNINFNIDDLSSKLNESINSA
MININKFLDQCSVSYLMNSMIPYAVKRLKDFDASVRDVLLKYIYDNRGTLIGQVNRLKDK
VNNTLSADIPFQLSKYVDNKKLLSTFTEYIKNITNASILSIVYKDDDLIDLSRYGAEIYN
GDKVYYNSIDKNQIRLINLESSTIEVILKKAIVYNSMYENFSTSFWIRIPKYFNSISLNN
EYTIINCMENNSGWKVSLNYGEIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTIT
NNRITKSKIYINGRLIDQKPISNLGNIHASNKIMFKLDGCRDPHRYIVIKYFNLFDKELS
EKEIKDLYDNQSNSGILKDFWGDYLQYDKSYYMLNLYDPNKYVDVNNVGIRGYMYLKGPR
DNVMTTNIYLNSSLYMGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQA
GVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAK
LVASNWYNRQIERSSRTLGCSWEFIPVDDGWRERPL
Download sequence
Identical sequences gi|229587275|ref|YP_002860313.1|NC_012654 515621.CLJ_0004 WP_012720356.1.34328 gi|229587275|ref|YP_002860313.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]