SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229587276|ref|YP_002860314.1| from Clostridium botulinum Ba4 str. 657

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229587276|ref|YP_002860314.1|
Domain Number 1 Region: 1-476
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.41e-155
Family Clostridium neurotoxins, catalytic domain 0.00012
Further Details:      
 
Domain Number 2 Region: 465-796
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 9.29e-119
Family Clostridium neurotoxins, "coiled-coil" domain 0.00039
Further Details:      
 
Domain Number 3 Region: 807-988
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.09e-35
Family Clostridium neurotoxins, the second last domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229587276|ref|YP_002860314.1|
Sequence length 1159
Comment botulinum neurotoxin type BivA4, nontoxic-nonhemagglutinin component, NTNH [Clostridium botulinum Ba4 str. 657]
Sequence
MKINNNFNINSLVDNRDVAIVRGRKTDALFKVFQVAPNIWIAPERYYGESLNINEDQKSD
GGIYDSSFLSTDNEKDEFLQATVKILQRINNNVIGAKLLSLISTAISFPYEYKPGDYRQT
NYLTSKYNEHYYTANLVIFGPGSNIIKNNVVYYKKEYAENGMGTMSEIWFQPFLTYKYDQ
FYVDPALELIKCLIKSLYYLYGIKPSDDLSIPYRLRSELNNSEYSQLNIVDFLISGGTDY
KLLNTNPYWITDNYFSDAPKNFEKYKNDYETKIKNNNDIANSIKLYLEQKFKTNVQDIWE
LNLSYFSTEFEIMMPEIFNNALNHYHRKEYYVIDYFKNYNINGFINGQIKTILPLSKYNK
NIINKPELIINLINENNSVLMKSNVYGDGLKGTMNNFYAVYKIPYNIGDEYHINYSYLNN
VNVEEINNIPPINDADIYPYRKNSDPFIPVYNITETKEINTTTPFSVNYLQAQVTNSNDI
NLSSDFSKVISSKDRSLVYSFLDNTIDYLDSIKYDEPIDTDKKYYLWLKEIFRNYSFDMT
ETQEVNIPCGINKVVPWLGKALNILNTGNSFIEEFKTLGPISLINKKENITMPKIEIDEI
PNSMLNLSFKDLSENLFNIFSKNNSYFEKIYYDFLDQWWTQYYSQYFDLICMAKRSVLAQ
ESLIKKIIQKKLSYLIGNSNISSDNLALMNLTTTNTLRDISNESQIAMNNVDSFLNSAAI
CVFESNIYPKFISFMEQCINNINKNTREFIQKCTNIIENEKLQLISQNIFSILDFDFLNI
EDLKSLFSSETALLIKEETSPYELVLYAFKEPGNNVIGDASGKDTSVEHSKDIGLVYGIN
SDALYLNGSDQSISFSNDFFENGLTNSFSIYFWLRNLGQDTTKSKLIGSKEDNCGWEIYF
QDTGLVFNMIDSNGDDKNIYLSDVSNNSWHYITISVDRLKEQLLIFIDDNLVVNESIKEI
LNIYSSNIISLLSNNNASYIEGLTILNKPTTGEEVLSNYFKDLNNSYIRDSNEERLEYNK
TYQLYNYVFPDNPIYEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKLDEVII
SVLDNMEKYIDISADNRLQLIDNKNSAKKMLISNDIFISNCLTLSYNGKYICLSMKDETY
NWMICNNDASKYLYLWSFK
Download sequence
Identical sequences WP_012720298.1.34328 gi|229587276|ref|YP_002860314.1| gi|229587276|ref|YP_002860314.1|NC_012654 515621.CLJ_0005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]