SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229587402|ref|YP_002860440.1| from Clostridium botulinum Ba4 str. 657

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229587402|ref|YP_002860440.1|
Domain Number 1 Region: 2-533
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.06e-208
Family Clostridium neurotoxins, catalytic domain 0.00000000000000225
Further Details:      
 
Domain Number 2 Region: 536-861
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 1.14e-126
Family Clostridium neurotoxins, "coiled-coil" domain 0.0000000000175
Further Details:      
 
Domain Number 3 Region: 1082-1291
Classification Level Classification E-value
Superfamily STI-like 4.74e-82
Family Clostridium neurotoxins, C-terminal domain 0.0000000017
Further Details:      
 
Domain Number 4 Region: 860-1066
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.42e-45
Family Clostridium neurotoxins, the second last domain 0.00000000822
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229587402|ref|YP_002860440.1|
Sequence length 1291
Comment botulinum neurotoxin type BvB, BoNT/BvB [Clostridium botulinum Ba4 str. 657]
Sequence
MPVTINNFNYNDPIDNNNIIMMEPPFARGMGRYYKAFKITDRIWIIPERYTFGYKPEDFN
KSSGIFNRDVCEYYDPDYLNTNDKKNIFLQTMIKLFNRIKSKPLGEKLLEMIINGIPYLG
DRRVPLEEFNTNIASVTVNKLISNPGEVERKKGIFANLIIFGPGPVLNENETIDIGIQNH
FASREGFGGIMQMKFCPEYVSVFNNVQENKGASIFNRRGYFSDPALILMHELIHVLHGLY
GIKVNDLPIVPNEKKFFMQSTDAIQAEELYTFGGQDPSIISPSTDKSIYDKVLQNFRGIV
DRLNKVLVCISDPNININIYKNKFKDKYKFVEDSEGKYSIDVESFDKLYKSLMFGFTETN
IAENYKIKTRASYFSDSLPPVKIKNLLDNEIYTIEEGFNISDKNMEKEYRGQNKAINKQA
YEEISKEHLAVYKIQMCKSVKAPGICIDVDNEDLFFIADKNSFSDDLSKNERIAYNTQNN
YIENDFSINELILDTDLISKIELPSENTESLTDFNVYVPVYKKQPAIKKIFTDENTIFQY
LYSQTFPLDIRDISLTSSFDDALLFSNKVYSFFSMDYIKTANKVVEAGLFAGWVKQIVDD
FVIEANKSSTMDKIADISLIVPYIGLALNVGNETAKGNFENAFEIAGASILLEFIPELLI
PVVGAFLLESYIDNKNKIIETINSALTKRDEKWIDMYGLIVAQWLSTVNTQFYTIKEGMY
KALNYQAQALEEIIKYKYNIYSEKERSNINIDFNDVNSKLNEGINQAIDNINNFINECSV
SYLMKKMIPLAVEKLLDFDNTLRKNLLNYIDENKLYLIGSAEYEKSKVDKYLKTSIPFDL
STYTNNTILIEIFNKYNSDILNNIILNLRYRDNKLIDLSGYGAKVEVYDGVKLNDKNQFK
LTSSANSKIRVIQNQNIIFNSMFLDFSVSFWIRIPKYKNDGIQNYIHNEYTIINCMKNNS
GWKISIRGNMIIWTLIDINGKIKSVFFEYSIKEDISEYINRWFFVTITNNSDNAKIYING
KLESHIDIRDIREVIANDEIIFKLDGNIDRTQFIWMKYFSIFNTELSQSNIEEIYKIQSY
SEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLKKDSSVGEILTRSKYNQNSKYINYRDLY
IGEKFIIRRKSNSQSINDDIVRKEDYIYLDFFNLNQEWRVYMYKYFKKEEEKLFLAPISD
SDEFYNTIQIKEYDEQPTYSCQLLFKKDEESTDEIGLIGIHRFYESGIVFKEYKDYFCIS
KWYLKEVKRKPYNSKLGCNWQFIPKDEGWTE
Download sequence
Identical sequences A2I2U6
WP_012720198.1.34328 gi|229587402|ref|YP_002860440.1|NC_012654 515621.CLJ_0133 gi|229587402|ref|YP_002860440.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]