SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|238925109|ref|YP_002938626.1| from Eubacterium rectale ATCC 33656

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238925109|ref|YP_002938626.1|
Domain Number 1 Region: 594-757
Classification Level Classification E-value
Superfamily Fibronectin type III 8.74e-18
Family Fibronectin type III 0.0044
Further Details:      
 
Domain Number 2 Region: 499-573
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000154
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 3 Region: 244-361
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000157
Family Collagen-binding domain 0.0038
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000471
Family Collagen-binding domain 0.0076
Further Details:      
 
Domain Number 5 Region: 368-472
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000628
Family Collagen-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238925109|ref|YP_002938626.1|
Sequence length 772
Comment protein tyrosine phosphatase, receptor type, J [Eubacterium rectale ATCC 33656]
Sequence
MKKKIIATLLSLAIVMSGSFSAFAADFSENSESTGVDSVTSMEESSESNKSAEELISDET
ISQDDIIGGSEIKDTASNQLDVENTGEAKDVEVQLNDGNSVDIMPSNSVEDEEINTESSV
KTYASDSESASQSIFVNKKNYGELSKSDEVDNYKFTLSSAGSVRIDFGKEYEDSNRGWTV
EVYNSNWEIIKRDEFRCGNSKTDSSSVLGLASGTYYLRIKGIRWEWTDTKYNFTLVYSAS
NSWEKEANNSFSTATKVNTNSVCYGSISNSDSTDIDYYKFSMANAGHIRIDFGKEYDSNA
DHGWNVILYNSEQEKYIEWTFNCGNSKTDSTCEYGLPKGTYYILIKPIDYDDTSVTYNFN
INFSSSAVWEKELNDDLATPNLMNVNTTYYGTTTSWNEDCYKFTLKKNGTVSIDFGKAYD
KDTSHGWDVRLYNTDREEVSKGDVYCGDTNIKSVISTDLVAGSYYLKVSPKAYDVSEVVY
NIKVTAKNEPAPAQSTVSAVSGLKIGGRAGDALRLNWNKNTSADGYIVEQYKSGSWTRIA
RIGSNSTVTYRVEKLSPSTKYNFRVKAFKLNGNAATYSSYKNISGITNPATISGLKIGGH
AADALRLNWTKNSKASGYIVEQYKGGKWTRIARIGENSTTTYRVEKLSASTTYKFRVQAF
GFDGKTALYGNYAYINGKTSPATVTGIRIGGTAKDALRVNWNKDSKASGYIVQQYKNGTW
VRIARIGNNNTTTYRVSGLKSGSTYIFRVQAFGYDGKTAIYGGFAMIPGTTK
Download sequence
Identical sequences C4ZHK5
515619.EUBREC_2762 WP_012743520.1.32465 gi|238925109|ref|YP_002938626.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]