SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|333978347|ref|YP_004516292.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333978347|ref|YP_004516292.1|
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.00000000000405
Family N-utilization substance G protein NusG, N-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 88-133
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000817
Family N-utilization substance G protein NusG, C-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333978347|ref|YP_004516292.1|
Sequence length 163
Comment NusG antitermination factor [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MQWYAVQVTTTHEKRIKKHLEKRKLNGLAGKIGEIIIPEKDGKPAFPGYVFVQAEAWPDL
YLPRTTIRCRTIGMVSEEEIKKLMRMDTPTTVQKQTVPKRTFKKGDRVVITIGPLAGIQG
VIEKAGAKRSRVSYFDGEVKIDADNELLRAYQDGDEPAGQGIL
Download sequence
Identical sequences F6CQP7
gi|333978347|ref|YP_004516292.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]