SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|255535006|ref|YP_003095377.1| from Flavobacteriaceae bacterium 3519-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255535006|ref|YP_003095377.1|
Domain Number 1 Region: 42-222,249-287
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 8.59e-37
Family Endonuclease I 0.0026
Further Details:      
 
Domain Number 2 Region: 296-385
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000195
Family Fibronectin type III 0.00077
Further Details:      
 
Weak hits

Sequence:  gi|255535006|ref|YP_003095377.1|
Domain Number - Region: 380-448
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 0.000235
Family Lamin A/C globular tail domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|255535006|ref|YP_003095377.1|
Sequence length 635
Comment endonuclease I [Flavobacteriaceae bacterium 3519-10]
Sequence
MIKLAQLNYYCMKRFLFLALLLPFSGFAQAPSGYYDGTAALTGYALKSKLHEIISEKNIN
WHYGDLPAFYNQTDLDRYYDHGVNNSTILLDIYSEIPAGADAYEYTSANLIGSASAEGLG
WNREHMVPQSTFNSSYPMYSDLFYVIPTDARINQLRSNYPYGKAGSLNYYTFRNGSKISR
NGTPNSGYTGRVYEPVDEFKGDIARSLLYFAVRYEGKLSSFNFYNGTSAANDTSPFDGTE
EKAFENWYIAMLLQWHQLDPVSPRETDRNNVVFTLQKNRNPFIDHPEWVTAIWSQTADAV
APQAPTNLQLQQNSAYFVNLSWATAPETDVLGYKIFQNGVLVATTRDTQVTIDHLQPATT
YNFTVKAYDNGYLESSDSNILEVSTLASDVFAKDLMITKYIEGSGQNNAIEITNKTGHPV
NLNKYRLSIQFYNGTNANYYFPDPYELEGTVQNNEPFVVLNPYSNLSCITNDEARFVTAA
PQLTFSGSQYLELRYASTTIDAIGTRSADNFAVLGNVSLYRLNSVSQPNSSFTLNEWQTY
PVNYCENIGTLAASGVATNQPKYSLYPNPLHGNTLYVSGQNLEKVLNIAVYDLSGKRIID
RVSPFKNTNAIDVGTLKSGVYILKIDDQSLKFIKN
Download sequence
Identical sequences C6X4H7
531844.FIC_00862 gi|255535006|ref|YP_003095377.1| WP_012782461.1.47966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]