SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|255535293|ref|YP_003095664.1| from Flavobacteriaceae bacterium 3519-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255535293|ref|YP_003095664.1|
Domain Number 1 Region: 34-237
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.11e-35
Family Endonuclease I 0.0015
Further Details:      
 
Domain Number 2 Region: 264-354
Classification Level Classification E-value
Superfamily Fibronectin type III 2.57e-17
Family Fibronectin type III 0.00021
Further Details:      
 
Weak hits

Sequence:  gi|255535293|ref|YP_003095664.1|
Domain Number - Region: 534-573
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0549
Family Cna protein B-type domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|255535293|ref|YP_003095664.1|
Sequence length 581
Comment hypothetical protein FIC_01152 [Flavobacteriaceae bacterium 3519-10]
Sequence
MIMKLKLSFFLSLCSFVIFAQSAPSYYDGVNFSKTGNALKADLASLITATHTKVISYDEL
KTLMRTSDADPAVSGNMLMIYGSQASGTHQRSRSANGSWNREHVYAKSKGTPNLGTSGPG
ADGHHLRPSDVTLNSTRGSLLFDDGTGAMAYKTSRGGWYPGDEWKGDVARILMYMYVRYN
VRCLPLNITMNPSTYSQDFPDILLKWNIEDPVSPFEITRNNVVAQTQKNRNPFIDNPYLA
TVVWGGPAAQNNWPDTFSGGTTGDTEAPSSPLNLTVTDTTSTSISLSWAASSDNVAVSSY
QVYADNVLKATVYNTLATVTGLNPATTYNFHVVAKDSSGNVSEKSAAVQGTTKEAPETGT
SCGTEDFENMQSVSSSYSEKNWSSNGIIWTATNARNDSQITIDGSKAVCVRKGSLKSSTI
SGGIGSLTVTTYLPFSDSAGNYLLKINGVMKGQIPYSKTATTTTIQNINVEGTVVIELVD
ETTNNRVSFDNLSWTCYSVLGNGNVEVKNQKFSVYPNPTTNREIFVSGIGSRETVNVYNM
AGQLVQTITNVDNNGKINLTNLQKGVYFITAKNQSAKLIVD
Download sequence
Identical sequences C6X5B4
gi|255535293|ref|YP_003095664.1| WP_015805887.1.47966 531844.FIC_01152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]