SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|255535785|ref|YP_003096156.1| from Flavobacteriaceae bacterium 3519-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255535785|ref|YP_003096156.1|
Domain Number 1 Region: 30-266
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 4.83e-37
Family Endonuclease I 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|255535785|ref|YP_003096156.1|
Sequence length 360
Comment endonuclease I [Flavobacteriaceae bacterium 3519-10]
Sequence
MKNSISLFLAVFMLNLFSAQIPTGYYSQANGLTGYTLKTKLKEIVTNGHQDNGYNGLWNA
YKVGDLDKFYENDNTILDIYSEKPLSADAYNYTPGANQCGNYNAEAVCYNREHLFPQGFF
DEAFPMKNDYLHIMPTDGYVNGKRNNFPFGTVGAASWTSTNGSKLGTSNFPGYGGTVFEP
INEFKGDIARSLLYFITRYEDKLQEFDYDDANNPQDGSKNRGFDQWYINLLLQWHQNDPV
SPKEIARNNYAYTYQKNRNPFIDHPEYVTLIWTSTLATESADLTENVLRISNNPVRNGEL
TVNGKNITTIASAQIISAAGQVVQTLKEPFKNSNKIILNNKTKGIYFLKTEGQSVKFIVE
Download sequence
Identical sequences C6X0Y1
gi|255535785|ref|YP_003096156.1| 531844.FIC_01650 WP_015806379.1.47966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]