SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|255535786|ref|YP_003096157.1| from Flavobacteriaceae bacterium 3519-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|255535786|ref|YP_003096157.1|
Domain Number 1 Region: 45-277
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 2.94e-41
Family Endonuclease I 0.0013
Further Details:      
 
Domain Number 2 Region: 292-469
Classification Level Classification E-value
Superfamily Fibronectin type III 8.2e-24
Family Fibronectin type III 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|255535786|ref|YP_003096157.1|
Sequence length 695
Comment endonuclease I [Flavobacteriaceae bacterium 3519-10]
Sequence
MVFVTLRSKIFILNQMKKLTTLLLGFLFSMAVAQAPPTYYNGTDGLTGAALKSKLSQIIS
AGASDRGYDGLYTGYPTTDSDHFYENDGTVLDMYSENPAGTDPYTYRHGQKRCGNYSVEG
DCYNREHVIPQSFFKSRAPMVSDIHHIRPTDGKVNGMRSNYPFGAVANPSYTSKNGSKVG
PSSSPGYGGTVFEPIDEFKGDIARMVFYFVTRYESQLSGFSAGNMLGGSSYPGLQLWERD
VLLAWSALDPVSPTEIERNNASYVFQNNRNPYIDRPEWVQQVWGTQVIDTQAPSAPANLV
LSSTTTAAANLTWSASTDNIGVAYYKIYVNGQFHSNSNTTTATVSGLTQGTAYNFYVVAT
DAAGNVSAPSNTVTGTTLTDTVAPTAPVNLSVTSVGTNNIAVQWVAATDNIGVATYDIYV
NGDLVGSSSATSTNIANLAPATAYSIYILAKDAAGNVSAPSNTVTATTAAVGVDCGNENF
DSIPASSPNYSTYNWTSNGISWTSEDSRTDQTINGKALTIRNGFLTALSVPNGIGDLTVT
TQLKFSGSPGTLQILVNGVDTGKTVPYSSTATTTTVTGINISGTVEITLQNNSTTNRVAI
DNMKWTCYTVAGVNDSAADKNALSIYPNPVKNGELNVKGNNLNKIEVAQIFEFTGKLVQT
VAQPFKNSTTIKLKNLPGGVYILKAGNSSTKFIVQ
Download sequence
Identical sequences C6X0Y2
gi|255535786|ref|YP_003096157.1| 531844.FIC_01651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]