SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257386940|ref|YP_003176713.1| from Halomicrobium mukohataei DSM 12286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257386940|ref|YP_003176713.1|
Domain Number 1 Region: 7-131
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.86e-36
Family YigZ N-terminal domain-like 0.00027
Further Details:      
 
Domain Number 2 Region: 137-199
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000317
Family YigZ C-terminal domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257386940|ref|YP_003176713.1|
Sequence length 203
Comment hypothetical protein Hmuk_0876 [Halomicrobium mukohataei DSM 12286]
Sequence
MTDEAYDTVAGRGEAAFEVQGSEFIGRVCPAHTVDEAEAFVDAVSGEYADATHNVPAYRV
RADPLREYSSDDGEPSGSAGKPALNVLQQREIENVAAVVTRYYGGTNLGVGGLARAYSRA
VKDAVDDAGITTERPHERLTVTVDYDDSGTVRGIVESTGVEFDASYEATVTFDLRVPVAE
ADTLRERIASATSGRARIGSSDD
Download sequence
Identical sequences C7P0M4
WP_015761853.1.83741 485914.Hmuk_0876 gi|257386940|ref|YP_003176713.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]