SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257387211|ref|YP_003176984.1| from Halomicrobium mukohataei DSM 12286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257387211|ref|YP_003176984.1|
Domain Number 1 Region: 44-168
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000902
Family Sfri0576-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257387211|ref|YP_003176984.1|
Sequence length 182
Comment hypothetical protein Hmuk_1151 [Halomicrobium mukohataei DSM 12286]
Sequence
MLEIAYNYPYNSSQFNNQVIESPTMIDRETVTAAFDDYRPDPNDAMFEVLTEPEPAVVAI
RVGDCSPAGFRDLYRLLSATTDAHDTVHLYEETVDWTARSALSNCYGILPDLRRGSSFDI
GRYAAVGDSVWARGLFDCWRAIAPVWPVSPDEMRYFGPGEREAARTWVRTGELPVDRGKE
SQ
Download sequence
Identical sequences C7P248
485914.Hmuk_1151 gi|257387211|ref|YP_003176984.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]