SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257388175|ref|YP_003177948.1| from Halomicrobium mukohataei DSM 12286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257388175|ref|YP_003177948.1|
Domain Number 1 Region: 1-160
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.59e-31
Family GHMP Kinase, N-terminal domain 0.00021
Further Details:      
 
Domain Number 2 Region: 173-321
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.87e-30
Family Mevalonate 5-diphosphate decarboxylase 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257388175|ref|YP_003177948.1|
Sequence length 323
Comment diphosphomevalonate decarboxylase [Halomicrobium mukohataei DSM 12286]
Sequence
MKATAKAHPIQGIVKYHGMRDEELRLPYHDSISVCTAPSHSKTTAAFDPELDADEYVIDG
EPVEGRGAERIAAVVDHVRELAGIDHRVRFESENTFPTNIGFGSSASGFAAAAMALVEAA
GLDMTRPEVSTVARRGSCSAARAVTGGFSHLKNGMNDADCRSERIETELEEDLRVVAGMV
PSYKETEAAHEEAAASHMFENRMAHIHGQIAEARDAIAAGAFDRTFELAEHDSLSLAATT
MTGPAGWVYWQPRTIEIFNAVRELREEGVPVYFSVDTGASVYVNTTAEHVDRVEETVADC
GVDTRVWEVGGPARVLDDSEALF
Download sequence
Identical sequences C7NWN1
WP_015763083.1.83741 485914.Hmuk_2128 gi|257388175|ref|YP_003177948.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]