SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257388555|ref|YP_003178328.1| from Halomicrobium mukohataei DSM 12286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257388555|ref|YP_003178328.1|
Domain Number 1 Region: 2-254
Classification Level Classification E-value
Superfamily Aquaporin-like 4.32e-66
Family Aquaporin-like 0.0000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257388555|ref|YP_003178328.1|
Sequence length 255
Comment MIP family channel protein [Halomicrobium mukohataei DSM 12286]
Sequence
MNPYIAEAIGTAILIIFGGGVVANVVLNETKGHESGWIVITWGWAIGVFMGVFTISQVSG
GHINPAVTIGLAAAGLFDWAQVPIYIAAQTLGAFLGGVVVWLAYKDHFAATEDEDVKLAI
FSTSPEIRNYRANMLTEVIGTFVLVFGVLYLNSAGFLDGASGEFLRTITIDGQEVGFGLG
ALSALPVALVVLGIGLSLGGPTGYAINPARDFGPRIAHAVLPFPHKGSSDWAYSWVPIVG
PIIGALLAAGLYHAL
Download sequence
Identical sequences C7NYT2
gi|257388555|ref|YP_003178328.1| WP_015763463.1.83741 485914.Hmuk_2513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]