SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257388635|ref|YP_003178408.1| from Halomicrobium mukohataei DSM 12286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257388635|ref|YP_003178408.1|
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.05e-32
Family Translational machinery components 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257388635|ref|YP_003178408.1|
Sequence length 132
Comment 30S ribosomal protein S9 [Halomicrobium mukohataei DSM 12286]
Sequence
MVTNTSGKKKTAVARATVREGEGRVRIDSQPVELVDPELAQLKMLEPFRIADDDLREQVD
VEVSVEGGGVMGQADAARTAIARGLVDHTNDAELRDAFMEFDRSLLVNDVRQSEAKKWGG
PGARARYQKSYR
Download sequence
Identical sequences C7NZ12
WP_015763543.1.83741 WP_015763543.1.97429 485914.Hmuk_2595 gi|257388635|ref|YP_003178408.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]