SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221229960|ref|YP_002503376.1| from Mycobacterium leprae Br4923

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221229960|ref|YP_002503376.1|
Domain Number 1 Region: 27-287
Classification Level Classification E-value
Superfamily Cgl1923-like 1.57e-87
Family Cgl1923-like 0.000000537
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|221229960|ref|YP_002503376.1|
Sequence length 326
Comment hypothetical protein MLBr_01009 [Mycobacterium leprae Br4923]
Sequence
MSHSHYQDPDDEQHYQPGQPGMYVLEFPAPQLLASDGRGPVLIHALEGFSDAGHAIRLAA
THLKAALNTELVASFAIDELLDYRSRRPLMTFKTDHFTHYDDPELSLYALRDSVGTPFLL
LAGMEPDLKWERFITAVRLLAERLGVRQTISLGTVPMAVPHTRPITLTAHSNNGELIADF
TPWITEIQVPGSASNLLEYRMGQHGHEVVGFTVHVPHYLTQTDYPAAAQALLEQVAKTGA
LQLPLSALAEAAAEIRAKIDEQVQASTEVAQVVAALERQYDAFIDAQENRSLLRRDEDLP
SGDELGAEFERFLAQQAEKKRDDDLT
Download sequence
Identical sequences A0A0H3MQ87 A0A197SEY4 Q49847 Q7AQB4
272631.ML1009 561304.MLBr_01009 gi|221229960|ref|YP_002503376.1| NP_301746.1.10168 WP_010908070.1.20769 WP_010908070.1.50976 WP_010908070.1.86095 gi|15827483|ref|NP_301746.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]