SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221230153|ref|YP_002503569.1| from Mycobacterium leprae Br4923

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221230153|ref|YP_002503569.1|
Domain Number 1 Region: 2-244
Classification Level Classification E-value
Superfamily Cgl1923-like 6.8e-84
Family Cgl1923-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221230153|ref|YP_002503569.1|
Sequence length 274
Comment hypothetical protein MLBr_01306 [Mycobacterium leprae Br4923]
Sequence
MAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQVDGVTRELVW
PAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIADRLNVDTVVILGALLADTPH
TRPVPVSGAAYSPESARRFGLEETRYEGPTGIAGVFQDACVAARIPAVMFWAAVPHYVSH
PPNPKATVALLRRVEDVLDVEVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGD
AEVDVNDALGKIDGDALAAEFERYLRRRRPGFGR
Download sequence
Identical sequences A0A0H3MQR7 Q9CC38
gi|15827676|ref|NP_301939.1| NP_301939.1.10168 WP_010908260.1.20769 WP_010908260.1.50976 WP_010908260.1.86095 272631.ML1306 561304.MLBr_01306 gi|221230153|ref|YP_002503569.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]