SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|378962713|ref|YP_005220199.1| from Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378962713|ref|YP_005220199.1|
Domain Number 1 Region: 3-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.07e-17
Family DsbA-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378962713|ref|YP_005220199.1|
Sequence length 138
Comment Thiol:disulfide interchange protein [Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12]
Sequence
MIKYHVSLLGPLGHELTQAWALAMMMKETDVVEKAFFTADMVEKRLHSPDDVRRVFMSAT
GISRGEYDRSIKSPAVNDMVALQERLFKEYGVRGTPSVYVRGRYHINNAAFGAFSVEDFR
SRYAAVVRKLLAGNPDAD
Download sequence
Identical sequences gi|378962713|ref|YP_005220199.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]