SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148655463|ref|YP_001275668.1| from Roseiflexus sp. RS-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148655463|ref|YP_001275668.1|
Domain Number 1 Region: 5-79
Classification Level Classification E-value
Superfamily TPR-like 0.000000552
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Weak hits

Sequence:  gi|148655463|ref|YP_001275668.1|
Domain Number - Region: 118-147
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00973
Family Cytochrome c3-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148655463|ref|YP_001275668.1|
Sequence length 185
Comment hypothetical protein RoseRS_1314 [Roseiflexus sp. RS-1]
Sequence
MSDVDLARWLYEGALALSEGRREEARRLLMQVIEHDEQNEQAWLWLSGAVDDPADQQIAL
ENVLAINPRNAAAQAGLAWLRDQGRSASASEPIPVAPATPHDRSGPWVPPPPYDENDVVE
IMCWQCQATLYSVAPFCWQCHAPVHSCNNCVFRDDPRCKPLQGLTNPLAWAAVNECPWWR
PAAQR
Download sequence
Identical sequences A5USW5
357808.RoseRS_1314 WP_011956070.1.23570 gi|148655463|ref|YP_001275668.1| 2010245736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]