SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148655682|ref|YP_001275887.1| from Roseiflexus sp. RS-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148655682|ref|YP_001275887.1|
Domain Number 1 Region: 25-160
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 6.54e-27
Family GntR ligand-binding domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148655682|ref|YP_001275887.1|
Sequence length 176
Comment GntR family transcriptional regulator [Roseiflexus sp. RS-1]
Sequence
MPAATQGLVQISPRRGVFVIELSIDEFREIYSIREVLEELAIQQALPHMTPAHLDYVSQI
NARFIQAIQDRAFATALEINQEFHLALYEPAQQPLLIDLISSLSTRSMRYRQIYVNLPNR
AQQAIVDHETILAACRNWDVVAAGQAVRSHLRRTLEGVLATLKVSPESDHHPSDCS
Download sequence
Identical sequences A5UTI4
357808.RoseRS_1545 gi|148655682|ref|YP_001275887.1| WP_011956286.1.23570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]