SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148658031|ref|YP_001278236.1| from Roseiflexus sp. RS-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148658031|ref|YP_001278236.1|
Domain Number 1 Region: 2-128
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 8.89e-32
Family Thiamin pyrophosphokinase, catalytic domain 0.0018
Further Details:      
 
Domain Number 2 Region: 148-209
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.00000000144
Family Thiamin pyrophosphokinase, substrate-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148658031|ref|YP_001278236.1|
Sequence length 221
Comment thiamine pyrophosphokinase [Roseiflexus sp. RS-1]
Sequence
MYVVIVANAPSLSLDPYRSLITDADVVIAADGGANALVEAHLRPSLVIGDLDSLDDARLA
ALAADGVELRRFPREKDETDLELALLHAAAIGAERIDVLGALGGRWDHTFANVAMLAMPE
LCGRQVRLIDERQRLFLVRDQATLDGSPGDTLSLLPLTPVVHGITTRGLFYALHDATLHF
ERARGVSNILIDPPGFVSLREGLLLVVQHDDRGALQWNVGR
Download sequence
Identical sequences A5V083
WP_011958626.1.23570 gi|148658031|ref|YP_001278236.1| 357808.RoseRS_3933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]