SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152980347|ref|YP_001351871.1| from Janthinobacterium sp. Marseille

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152980347|ref|YP_001351871.1|
Domain Number 1 Region: 7-368
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.01e-105
Family O-acetyltransferase 0.0000000487
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152980347|ref|YP_001351871.1|
Sequence length 385
Comment homoserine O-acetyltransferase [Janthinobacterium sp. Marseille]
Sequence
MTSIGIVSPQSMFFDTPLPLQSGAQITDYTLVYETYGTLNADHSNAVLVCHALNASHHVA
GTYSEDAGTTGWWDNMVGPGKPLDTNKYFVIGVNNLGSCFGSTGPMHINPATGKQYGAHF
PVVTVEDWVQSQARLADALGIKQFAAVMGGSLGGMQALAWSILFPERLRHCVVIASTPKL
TAQNIAFDDVARQAILTDPDYHGGDFYAHGVVPKNGLRVARMLGHITYLSDDDMAAKFGR
ELRSGSYQFGFGIDFEIESYLRYQGDKFSTYFDANTYLLITKALDYFDPAKDFGGDLTKT
LSNTRAKFLLVSFTTDWRFSPERSHEMVQALVNNNRTVTYAEIDAPHGHDAFLLDDQRYM
NVVRSYFERAYEEIDGGSLKAGASA
Download sequence
Identical sequences A6SUC4
375286.mma_0181 gi|152980347|ref|YP_001351871.1| WP_011979407.1.39695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]