SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145295828|ref|YP_001138649.1| from Corynebacterium glutamicum R

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145295828|ref|YP_001138649.1|
Domain Number 1 Region: 8-272
Classification Level Classification E-value
Superfamily Cgl1923-like 4.05e-85
Family Cgl1923-like 0.000000000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145295828|ref|YP_001138649.1|
Sequence length 319
Comment hypothetical protein cgR_1753 [Corynebacterium glutamicum R]
Sequence
MSDNNDRMYELEYPSPEVSGQTAGGPTLIVALQGYADAGHAVESSSSHLMDALDHRLIAS
FNNDELIDYRSRRPVVVIEHNEVTSMDELNLGLHVVRDNDNKPFLMLSGPEPDLRWGDFS
NAVVDLVEKFGVENTICLYAAPMTVPHTRPTVVTAHGNSTDRLKDQVSLDTRMTVPGSAS
LMLEKLLKDKGKNVSGYTVHVPHYVSASPYPAATLKLLQSIADSADLNLPLLALERDAEK
VHRQLMEQTEESSEIQRVVGALEQQYDSELERYRSRHPQAVMPGESELPSGDEIGAEFEK
FLADLDDQGGSDHKETPEA
Download sequence
Identical sequences A4QET1
gi|145295828|ref|YP_001138649.1| 340322.cgR_1753 WP_011897367.1.2455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]