SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148825839|ref|YP_001290592.1| from Haemophilus influenzae PittEE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148825839|ref|YP_001290592.1|
Domain Number 1 Region: 2-195
Classification Level Classification E-value
Superfamily CAC2185-like 3.01e-86
Family CAC2185-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148825839|ref|YP_001290592.1|
Sequence length 196
Comment bicyclomycin/multidrug efflux system [Haemophilus influenzae PittEE]
Sequence
MNKCQRFFINRSLQRKLTNQGMTVISANCVGAFILHDLHQPFNSPFVNLCLSPQDFLRYL
QNMDFYRTQPLTFVQTEKSYPVGKLADLEIHFMHYHSEQEANEKWQLRTSRMKLDNLFIM
MTDRDGVTEKDIQLFDQLPFKNKVIFTHKPYPAFKSACYIKGFEKQNQVGDIFEFSSWNG
KKYYDQFDYVKWFNQA
Download sequence
Identical sequences 374930.CGSHiEE_03970 gi|148825839|ref|YP_001290592.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]