SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|145224532|ref|YP_001135210.1| from Mycobacterium gilvum PYR-GCK

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145224532|ref|YP_001135210.1|
Domain Number 1 Region: 19-284
Classification Level Classification E-value
Superfamily Cgl1923-like 4.71e-88
Family Cgl1923-like 0.000000552
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145224532|ref|YP_001135210.1|
Sequence length 330
Comment hypothetical protein Mflv_3951 [Mycobacterium gilvum PYR-GCK]
Sequence
MADDAHDSGSRYQPEQTGMYELEFPGPQLSTPDGRGPVLIHALEGFSDAGHAIKLAAAHL
KNSLDTELVASFAIDELLDYRSRRPLMTFKTDHFTHYDEPELNLYALHDSVGTPFLLLSG
MEPDLRWERFVTAIRLLAERLGVRRVIGLGSIPMAVPHTRPMTLTAHSNDKELIAEHQPW
VGEVQVPGSASNLLEFRMAQHGYEVVGFTVHVPHYLAQTDYPSAAETLLAEVARTASLDI
PTAELTTAAAVVFDKINEQVTASAEVAQVVDALERQYDAFVAAQENRSLLARDEDLPSGE
ELGAEFERFLAQQAGEKKRKDGDDQPREGL
Download sequence
Identical sequences A4TCP4 E6TES4
gi|145224532|ref|YP_001135210.1| gi|315444863|ref|YP_004077742.1| 350054.Mflv_3951 WP_011894802.1.11461 WP_011894802.1.22401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]