SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113473962|ref|YP_720023.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113473962|ref|YP_720023.1|
Domain Number 1 Region: 1-577
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 4.19e-184
Family Prokaryotic type I DNA topoisomerase 0.00000000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113473962|ref|YP_720023.1|
Sequence length 874
Comment DNA topoisomerase I [Trichodesmium erythraeum IMS101]
Sequence
MSTLVIVESPTKARTIRNYLPSDYRVEASMGHVRDLPPSAEEIPEKFKGEKWAQLGVNVE
SDFEPIYVVPKDKKKTVKELKDALKEVDELLLATDEDREGESISWHLLQLLKPKVPTKRM
VFHEITPEAIRRAIDNCRNIDEQLVRAQETRRILDRLYGYTLSPVLWKKIARGLSAGRVQ
SVAVRLLVNRERQRQAFKRGGYWDLKASLEQEKTPFESKLVTLGGTKIATGNDFDENTGK
IVEGRNVILLDEAHAEALKEQLQHKPWTVNSFDERAVRRKPSPPFTTSTLQQEANRKLRM
GARQTMRTAQNLYEQGFITYMRTDSVHLSDEAIAAARSCVEKMYGPEYLSSEPRQYTTKS
KGAQEAHEAIRPAGKTFRTPQETGLKNQEFALYDLIWKRTVACQMADSRQTHITVNLQVE
DAGFRSNGKRIDFPGFLRAYVEGSDDPEVSLENQEVPLPAIKQGDHPACTEIEVVGHETQ
PPARFTEASLVKTLESEGIGRPSTYATVIGTIVDRGYAKLQSNALVPTFTAFAVTTLLEK
HFPEFVDVKFTARMEQTLDDISMGEAQWVPYLKKFYFGESGLDTQIKEQENQIDPKLART
IELDNLDANSEMTYRICIGKFGAYIEAENGENIVKASIPEDLTPSDLDPEQIEKLLKQKT
EGPQELGIHPEEDKSIYIMTGRYGPYVQLGDDSEGSKRKPKRASLPKGVNMEDVTLDLAV
GLLSLPRTLGTHPETGCKIQANLGRFGPYIVHDQGKEDGKDYRSLKVKDDVLTITLERAL
ELLAQPKRSRRGSAKAVLPLKDLGKHPEDGETVGVYDGRYGLYVKHGKVNASLPKDMSVE
DVTWEKALELLHAKASSKKSARGRKSTKSKAENN
Download sequence
Identical sequences Q11AC4
WP_011609954.1.43450 gi|113473962|ref|YP_720023.1| 203124.Tery_0027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]