SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|113474026|ref|YP_720087.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474026|ref|YP_720087.1|
Domain Number 1 Region: 414-728
Classification Level Classification E-value
Superfamily Subtilisin-like 4.06e-79
Family Subtilases 0.00000197
Further Details:      
 
Domain Number 2 Region: 188-272
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 5.1e-16
Family Hypothetical protein PA1324 0.0096
Further Details:      
 
Domain Number 3 Region: 748-840
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 0.000000000000719
Family Hypothetical protein PA1324 0.01
Further Details:      
 
Domain Number 4 Region: 927-1038
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000038
Family MAM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113474026|ref|YP_720087.1|
Sequence length 1336
Comment peptidase S8/S53 subtilisin kexin sedolisin [Trichodesmium erythraeum IMS101]
Sequence
MVTNMQMSELDMDILGVTEARLNDIITNTDDVNRNVTIEPLVIAEGQVLFDFDDISDTTG
SQGFGGQKVGDFFWSEDWAVIHKDSNPGSGYEYGNVSPPYSAFNGWSNPVSITSDQDFTL
NSAYLTSAWEDNLDIQLKGLNDGQEVHSKTVTVNNQGPTLVQFDFTDVDEVQFESNVHFV
IDDLVYEFEEEEPGSISGYNWEDLNGNSQWDDGEAVLEGWTIYIDENKNGQLDDGEKSTT
TDGDGYYEFKDLAPGTYVIAEVIQEGWTQTYPKVEAEIDTSLRSQSSLSSFSETDTISNG
NTKNTAADGSQVSASESETKFTGENLGLENSFVENEIIVKINNSLNDSEVSVLENLKTQI
GARTVKETKTSELEGLQLWKFDGDTIDVLNQLQENPVIEYAELNYKVQTNSEPPNDPMFK
DLWGLDNETKPEASIQALNAWDIQTGSKDIVVGVIDTGIDYSHPDLANNMWTNSGETPGN
GIDDDNNGYIDDYYGYDFAYDDGDPMDRQSHGTHVAGTIGAEGNNGVGVVGVNHQTDLMA
IKFLNDQGSGSTFDAILAVEYATMMGADITNNSWGGGGFSQGLYDAIAAAGEANSLFVAA
AGNSSRNTDNSPSYPASYDLENIIAVAATDKNDNMSGFSNYGATTVDLGAPGSGILSTVP
GERYASYSGTSMASPHVAGVAALVLAENPDLSYAEVKEIILDNVDSISALNGKTLTGGRL
NADNALSAMGSPPENPGTHTVELNSGETITDINFGNQEIIPGSISGVNWHDLDGNSQRDD
GEPVLEGWKIYIDENENGQLDDGETSTTTNENGYYEFMGLDPGTYSITEVIQDGWEQTYP
SKLEVIFEADFSSDDNQPDLDGFTLDNGFIPEQSLNILSRSGDGPGTLRGNPTEGLWHLS
TRRGDEPGHSAQDSMYYGDEATGDYDKGHTAGRIISPDIDLSDQGNAELSFNYFLETEDL
SPWDSAKVLISTDGGTNFEEIASNHDNKLEDPTTGWINATFDLNDYVGETIKISFEFNTG
DQIYNRYEGWYIDDVTVRASVESQYHKVELDNGETFDDIDFGNLALEAEPDLTIIEDEGT
ASFAQDKDKTYWIINNETQDEFQLHHKDGTTYNDESHPHWDGAAAEVGDSGYRFLLDGDK
GRKGQALVWDTDENGKIIKSSGWISDKTSLHDFEEEFNHDLNDDGLIGEPDLTIIEDDGT
ASFAQDKDKTYWIIDNDTQDQFQLHHKNGTTYNDESSQHWDGAAAEAVEGEEGGYRFLLD
GDKGRKGQAFVWDTDENGKIVGNSGWISDETSLDDLEKEFNHDLNDDGVIPASNNLEDEI
AAIDTNMIGLATANLF
Download sequence
Identical sequences Q11A60
WP_011610012.1.43450 203124.Tery_0117 gi|113474026|ref|YP_720087.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]