SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474072|ref|YP_720133.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474072|ref|YP_720133.1|
Domain Number 1 Region: 2-49
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000000000393
Family DNA helicase RuvA subunit, middle domain 0.016
Further Details:      
 
Domain Number 2 Region: 65-115
Classification Level Classification E-value
Superfamily DNA helicase RuvA subunit, C-terminal domain 0.00000366
Family DNA helicase RuvA subunit, C-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113474072|ref|YP_720133.1|
Sequence length 119
Comment Holliday junction DNA helicase RuvA [Trichodesmium erythraeum IMS101]
Sequence
MLSLTELPDLVQAIVGGNTRVLAKTPGVGAKTAERITLELKNKLAEWRQDAGLTTSVPVG
VMPAIQEEVEMTLLALGYTGQEVIQSLQAVSKDANMSKNTNAEDWIREAISWLSRSTQL
Download sequence
Identical sequences Q11A14
gi|113474072|ref|YP_720133.1| 203124.Tery_0168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]