SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474131|ref|YP_720192.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474131|ref|YP_720192.1|
Domain Number 1 Region: 343-538
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.21e-53
Family Ppx associated domain 0.00073
Further Details:      
 
Domain Number 2 Region: 147-330
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.97e-41
Family Ppx/GppA phosphatase 0.0013
Further Details:      
 
Domain Number 3 Region: 21-142
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.45e-34
Family Ppx/GppA phosphatase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113474131|ref|YP_720192.1|
Sequence length 544
Comment Ppx/GppA phosphatase [Trichodesmium erythraeum IMS101]
Sequence
MITSVPLVRFPAPLAGQNPILAAIDIGTNSLHLVVVKIDPNLPTFTIIDQDKETVRLGEC
GTKGNLKPEVMDRAIATLERFQQIAKSANAKQIITVATSAVREAPNGKEFLNRIADELNL
YVDLISGQEEARRIYLGVLSAMEFNNQPHVIIDIGGGSTELILGDSDTLRTLSSTKVGAV
RLTKEFVTTNPVSKSEFAYLQAYIRGLLERPTKNILANIKKGEKPQLVGTAGTIEALATI
NAYEKLGNVPAPLGGYQFSLTELEELVNKLRKLPISKRREILGMSEKRAEIILAGALVLH
EAMSLLEMESVTVCESSLREGVIVDWMLNHGLIEDHLRFQSSIRQRNTLKIAQKYQVNLE
YSERVAFWALYLFDQTMGVLHNWGSEERELLWSAAILHNCGIYVNHSEHHKHSYYLIRNG
ELLGYTQIEIEVIANLARYHRKSLCKKKHDHYQILPKRYQEMVSQLSSLLRLAVALDRRQ
KGAIANLTCWLNTKQQEFHLWLRPANPKDDCALELWSLENKKEAFEKEFGLKLIVNLESA
SLVT
Download sequence
Identical sequences Q119V5
gi|113474131|ref|YP_720192.1| WP_011610115.1.43450 203124.Tery_0231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]