SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474142|ref|YP_720203.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|113474142|ref|YP_720203.1|
Domain Number - Region: 45-100,145-204
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000133
Family PDEase 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113474142|ref|YP_720203.1|
Sequence length 286
Comment hypothetical protein Tery_0244 [Trichodesmium erythraeum IMS101]
Sequence
MFNSTELLIDAFIQRLISGYSHTYGGYKPDYSDIIAWAAGMALENIANSDALYHNVEHTV
LVTLVGQEILRGKHIREGGVSCEDWLHYHISLLCHDIGYVKGVCRQDREDLRLYATGVDN
MKVSLPRGATDASLTPYHVDRGKLFIDERFGGHKLIEAEMIKHNMELTRFPVPADKDHQD
KNNYPGLVRAADLIGQLSDPRYLQKISALFYEFEETGQNKVLGYNNPGDLRQGYPKFYWN
VVYSYVKDAIGYLNLTQQGKQIIANLNANVFRVEHDNSLPEIAFIR
Download sequence
Identical sequences Q119U4
WP_011610126.1.43450 gi|113474142|ref|YP_720203.1| 203124.Tery_0244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]