SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474224|ref|YP_720285.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474224|ref|YP_720285.1|
Domain Number 1 Region: 527-704
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.1e-52
Family N-acetylmuramoyl-L-alanine amidase-like 0.0000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113474224|ref|YP_720285.1|
Sequence length 706
Comment N-acetylmuramoyl-L-alanine amidase [Trichodesmium erythraeum IMS101]
Sequence
MKNIYSGNRLIFIKNTQMRTTLMLQWLLPSILSIFVLGSPSEAATLESWQFKVNQNELSF
TTEGGVQPKAQLATNPTRLIIDLPGTTLGSVRPSQAIGRAIKAIRVEQFDSQTARIVVEL
NNGYTIDPKQVQFRGISPSEWTVQIPSPQQITSTTNTDINFAPQSSPPPPQTLQQPSPPL
LLSPPLPFLKKERSSNQNRTRPTNSPLVNQVTTTGTPTLVEDVQIKKEGVVLKTSGRLPE
IELKKSVDRTWMTIDVLNSTLTAKGLKPSQRFNESGLTITQLTQLSTSPAVVRLTLSLPD
KRTQWQARAYAGGIAVWPEGEVQPTINEATGFVFLKSVELKNGTELVVTADKPINYTSGW
DSETGAYGITIYNAKIDDRFRLPKREVGSPLIWAKIRQEDPETVTILVKPATNVKIAEVT
QVTTQQLSLLMGWGNIGTAPPGWRPNSIEPSSSSKPSLFPRRYNSSSPNSLGENSLPQNR
LPRNSPENLRPRRWPFTWPRRNNQRSLNNDRRFPLQNQLPQSDGRVMIVIDPGHGGPMDF
GGVGFGGMREKDIVLPMSLEVAQILEQNNIQVVMTRKTDRDLDLPPRSELANRVGADLFV
SIHANAISMSRPDVNGLETFYYQSGQVLAQYIQNSMLEAFPTMNNRGVKRARFHVLRHTK
MPAALVEVGFVTGNYDSRILADPGQRSRMAQAIARGILKYVQVYYR
Download sequence
Identical sequences Q119L2
gi|113474224|ref|YP_720285.1| 203124.Tery_0339 WP_011610208.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]